PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G016020_P01
Common NameP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB_related
Protein Properties Length: 88aa    MW: 10021.6 Da    PI: 9.775
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G016020_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.3e-191461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rgrWT+eEd+ll+++++++G g+W++ ++  g+ R++k+c++rw +yl
  GRMZM2G016020_P01 14 RGRWTAEEDQLLANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                       8*******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129422.241965IPR017930Myb domain
SMARTSM007173.0E-131363IPR001005SANT/Myb domain
PfamPF002498.4E-181461IPR001005SANT/Myb domain
SuperFamilySSF466892.63E-221588IPR009057Homeodomain-like
CDDcd001671.13E-101661No hitNo description
Gene3DG3DSA:1.10.10.601.0E-76588IPR009057Homeodomain-like
PROSITE profilePS512947.6526688IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDQLLANYIA EHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADVKRGNI SKEEEDIIIK LHATLGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-13128825100MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.5841e-146meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G016020
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00668SELEX16381825Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G016020_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283951e-146KJ728395.1 Zea mays clone pUT6679 MYB transcription factor (MYB3) mRNA, partial cds.
GenBankZMU570021e-146U57002.1 Zea mays P protein (P) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008654735.15e-59PREDICTED: LOW QUALITY PROTEIN: myb-related protein P-like
RefseqXP_008654736.18e-59PREDICTED: myb-related protein P-like isoform X1
SwissprotP278984e-58MYBP_MAIZE; Myb-related protein P
TrEMBLA0A096PZZ65e-59A0A096PZZ6_MAIZE; MYB-related transcription factor
STRINGGRMZM2G016020_P011e-58(Zea mays)
STRINGGRMZM2G057027_P021e-57(Zea mays)
STRINGGRMZM2G087316_P011e-58(Zea mays)
STRINGGRMZM2G129872_P011e-58(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.12e-51myb domain protein 12
Publications ? help Back to Top
  1. Athma P,Grotewold E,Peterson T
    Insertional mutagenesis of the maize P gene by intragenic transposition of Ac.
    Genetics, 1992. 131(1): p. 199-209
    [PMID:1317315]
  2. Grotewold E,Athma P,Peterson T
    Alternatively spliced products of the maize P gene encode proteins with homology to the DNA-binding domain of myb-like transcription factors.
    Proc. Natl. Acad. Sci. U.S.A., 1991. 88(11): p. 4587-91
    [PMID:2052542]